SCOPe 2.03: Domain d2ck2a_: 2ck2 A:

Lineage for d2ck2a_ (2ck2 A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188649] (10 PDB entries)

8. Domain d2ck2a_: 2ck2 A: [203800]
   automated match to d2cuma1
   complexed with ace; mutant

Details for d2ck2a_

PDB Entry: 2ck2, 2 Å

PDB Description: structure of core-swapped mutant of fibronectin

PDB Compounds: (A:) human fibronectin

SCOPe Domain Sequences for d2ck2a_:

Sequence, based on SEQRES records:

>d2ck2a_ b.1.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vsdvprdievvavtptsaliswdapavtiryirltygetggnspvqeitlpgskstytis
glkpgtdytvtlysvtgrgdspasskpasinfrtei

Sequence, based on observed residues (ATOM records):

>d2ck2a_ b.1.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vsdvprdievvavtptsaliswdapavtiryirltygetggnspvqeitlpgskstytis
glkpgtdytvtlysvtgrgpasskpasinfrtei

Timeline for d2ck2a_:

• d2ck2a_ is new in SCOPe 2.03-stable
  
• d2ck2a_ appears in SCOPe 2.04
  
• d2ck2a_ appears in the current release, SCOPe 2.08