SCOP 1.67: Domain d1c12a1: 1c12 A:1-107

Lineage for d1c12a1 (1c12 A:1-107)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (160 PDB entries)

8. Domain d1c12a1: 1c12 A:1-107 [20380]
   Other proteins in same PDB: d1c12a2, d1c12b1, d1c12b2
   part of antibody directed against the musk odorant traseolide
   complexed with trz

Details for d1c12a1

PDB Entry: 1c12, 2.6 Å

PDB Description: insight in odorant perception: the crystal structure and binding characteristics of antibody fragments directed against the musk odorant traseolide

SCOP Domain Sequences for d1c12a1:

Sequence; same for both SEQRES and ATOM records:

>d1c12a1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
dieltqspssmsvslgdtvsitchasqgissnigwlqqkpgksfkgliyhgtnledgvps
rfsgsgsgadysltisslesedfadyycvqyvqfpftfgsgtkleik

Timeline for d1c12a1:

• d1c12a1 first appeared (with stable ids) in SCOP 1.55
  
• d1c12a1 appears in SCOP 1.65
  
• d1c12a1 appears in SCOP 1.69
  
• d1c12a1 appears in the current release, SCOPe 2.08