Lineage for d2chza1 (2chz A:144-322)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2932904Family d.15.1.5: Ras-binding domain, RBD [54263] (14 proteins)
    contains Pfam PF00788 and Pfam PF02196
  6. 2932926Protein Phoshoinositide 3-kinase (PI3K) [54274] (2 species)
    includes parts of the flanking linkers
  7. 2932927Species Human (Homo sapiens) [TaxId:9606] [54276] (77 PDB entries)
  8. 2932981Domain d2chza1: 2chz A:144-322 [203795]
    Other proteins in same PDB: d2chza2, d2chza3, d2chza4
    automated match to d1e8ya3
    complexed with 093

    has additional insertions and/or extensions that are not grouped together

Details for d2chza1

PDB Entry: 2chz (more details), 2.6 Å

PDB Description: a pharmacological map of the pi3-k family defines a role for p110alpha in signaling: the structure of complex of phosphoinositide 3-kinase gamma with inhibitor pik-93
PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d2chza1:

Sequence, based on SEQRES records: (download)

>d2chza1 d.15.1.5 (A:144-322) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdipe
sqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee

Sequence, based on observed residues (ATOM records): (download)

>d2chza1 d.15.1.5 (A:144-322) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakdfvlrvcgr
deylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee

SCOPe Domain Coordinates for d2chza1:

Click to download the PDB-style file with coordinates for d2chza1.
(The format of our PDB-style files is described here.)

Timeline for d2chza1: