![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.97: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48162] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.97.1: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48163] (3 families) ![]() |
![]() | Family a.97.1.0: automated matches [227179] (1 protein) not a true family |
![]() | Protein automated matches [226898] (4 species) not a true protein |
![]() | Species Synechococcus elongatus [TaxId:32046] [225114] (1 PDB entry) |
![]() | Domain d2cfoa2: 2cfo A:312-485 [203785] Other proteins in same PDB: d2cfoa1, d2cfob1 automated match to d1j09a1 protein/RNA complex; complexed with glu |
PDB Entry: 2cfo (more details), 2.45 Å
SCOPe Domain Sequences for d2cfoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cfoa2 a.97.1.0 (A:312-485) automated matches {Synechococcus elongatus [TaxId: 32046]} dwdklnwlnrqyiqqlepeeflaeliplwqgagyafdeerdrpwlfdlaqllqpglntlr eaidqgavffipsvtfdseamaqlgqpqsatilayllehlpaepaltvamgqqliqqaak aagvkkgatmrtlraaltgavhgpdlmaawqilhqrgwdeprlaaalkqaqtts
Timeline for d2cfoa2: