Lineage for d2cfoa1 (2cfo A:2-311)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1590099Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1590100Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1590710Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 1590711Protein automated matches [190459] (36 species)
    not a true protein
  7. 1590886Species Synechococcus elongatus [TaxId:32046] [225113] (1 PDB entry)
  8. 1590887Domain d2cfoa1: 2cfo A:2-311 [203784]
    Other proteins in same PDB: d2cfoa2, d2cfob2
    automated match to d1glna2
    protein/RNA complex; complexed with glu

Details for d2cfoa1

PDB Entry: 2cfo (more details), 2.45 Å

PDB Description: non-discriminating glutamyl-trna synthetase from thermosynechococcus elongatus in complex with glu
PDB Compounds: (A:) Glutamyl-tRNA synthetase

SCOPe Domain Sequences for d2cfoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cfoa1 c.26.1.0 (A:2-311) automated matches {Synechococcus elongatus [TaxId: 32046]}
tvrvrlapsptgnlhigtartavfnwlyarhrggkfilriedtdrersrpeytenilegl
qwlgltwdegpyfqsdrldlyrqaiqtlldkglayycyctpeelealraeqkakgqapry
dnrhrhltpeeqaafeaagrtpvirfkieddrqiewqdlvrgrvswqgadlggdmviara
aprgeigyplynlvvvvddiamgitdvirgedhigntpkqillyealgatppnfahtpli
lnstgqklskrdgvtsisdframgylapalanymtllgwsppegvgelftldlaakhfsf
erinkagarf

SCOPe Domain Coordinates for d2cfoa1:

Click to download the PDB-style file with coordinates for d2cfoa1.
(The format of our PDB-style files is described here.)

Timeline for d2cfoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cfoa2