Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
Protein automated matches [190459] (36 species) not a true protein |
Species Synechococcus elongatus [TaxId:32046] [225113] (1 PDB entry) |
Domain d2cfoa1: 2cfo A:2-311 [203784] Other proteins in same PDB: d2cfoa2, d2cfob2 automated match to d1glna2 protein/RNA complex; complexed with glu |
PDB Entry: 2cfo (more details), 2.45 Å
SCOPe Domain Sequences for d2cfoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cfoa1 c.26.1.0 (A:2-311) automated matches {Synechococcus elongatus [TaxId: 32046]} tvrvrlapsptgnlhigtartavfnwlyarhrggkfilriedtdrersrpeytenilegl qwlgltwdegpyfqsdrldlyrqaiqtlldkglayycyctpeelealraeqkakgqapry dnrhrhltpeeqaafeaagrtpvirfkieddrqiewqdlvrgrvswqgadlggdmviara aprgeigyplynlvvvvddiamgitdvirgedhigntpkqillyealgatppnfahtpli lnstgqklskrdgvtsisdframgylapalanymtllgwsppegvgelftldlaakhfsf erinkagarf
Timeline for d2cfoa1: