SCOPe 2.07: Domain d2cfhb_: 2cfh B:

Lineage for d2cfhb_ (2cfh B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.278: Ligand-binding domain in the NO signalling and Golgi transport [111125] (1 superfamily)
   an N-terminal helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomain enclose a ligand-binding cavity

4. Superfamily d.278.1: Ligand-binding domain in the NO signalling and Golgi transport [111126] (4 families)

5. Family d.278.1.2: TRAPP components [118076] (3 proteins)
   Pfam PF04051; form homo- and hetero-dimers with the first two helices of one subunit complementing the fold of the other subunit to the H-NOX domain fold

6. Protein automated matches [190535] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187502] (4 PDB entries)

8. Domain d2cfhb_: 2cfh B: [203783]
   automated match to d1wc8a_
   complexed with plm

Details for d2cfhb_

PDB Entry: 2cfh, 2.3 Å

PDB Description: structure of the bet3-tpc6b core of trapp

PDB Compounds: (B:) Trafficking protein particle complex subunit 3

SCOPe Domain Sequences for d2cfhb_:

Sequence; same for both SEQRES and ATOM records:

>d2cfhb_ d.278.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sselftltygalvtqlckdyendedvnkqldkmgfnigvrliedflarsnvgrchdfret
adviakvafkmylgitpsitnwspagdefslilennplvdfvelpdnhssliysnllcgv
lrgalemvqmaveakfvqdtlkgdgvteirmrfirriednlp

Timeline for d2cfhb_:

• d2cfhb_ first appeared in SCOPe 2.03
  
• d2cfhb_ appears in SCOPe 2.06
  
• d2cfhb_ appears in the current release, SCOPe 2.08