Lineage for d2ce4b2 (2ce4 B:99-210)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1647686Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 1647687Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 1647688Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. Protein automated matches [226880] (4 species)
    not a true protein
  7. 1647946Species Deinococcus radiodurans [TaxId:243230] [225053] (2 PDB entries)
  8. 1647952Domain d2ce4b2: 2ce4 B:99-210 [203781]
    Other proteins in same PDB: d2ce4a1, d2ce4b1
    automated match to d1y67a2
    complexed with mn

Details for d2ce4b2

PDB Entry: 2ce4 (more details), 2.2 Å

PDB Description: manganese superoxide dismutase (mn-sod) from deinococcus radiodurans
PDB Compounds: (B:) Superoxide dismutase [Mn]

SCOPe Domain Sequences for d2ce4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ce4b2 d.44.1.1 (B:99-210) automated matches {Deinococcus radiodurans [TaxId: 243230]}
psgelldainsafgsfdafkqkfedaaktrfgsgwawlvvkdgkldvvstanqdnplmge
aiagvsgtpilgvdvwehayylnyqnrrpdylaafwnvvnwdevskryaaak

SCOPe Domain Coordinates for d2ce4b2:

Click to download the PDB-style file with coordinates for d2ce4b2.
(The format of our PDB-style files is described here.)

Timeline for d2ce4b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ce4b1