SCOPe 2.08: Domain d2ce4b1: 2ce4 B:-1-87

Lineage for d2ce4b1 (2ce4 B:-1-87)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (39 species)
   not a true protein

7. Species Deinococcus radiodurans [TaxId:243230] [225052] (2 PDB entries)

8. Domain d2ce4b1: 2ce4 B:-1-87 [203780]
   Other proteins in same PDB: d2ce4a2, d2ce4b2
   automated match to d1y67a1
   complexed with mn

Details for d2ce4b1

PDB Entry: 2ce4, 2.2 Å

PDB Description: manganese superoxide dismutase (mn-sod) from deinococcus radiodurans

PDB Compounds: (B:) Superoxide dismutase [Mn]

SCOPe Domain Sequences for d2ce4b1:

Sequence; same for both SEQRES and ATOM records:

>d2ce4b1 a.2.11.0 (B:-1-87) automated matches {Deinococcus radiodurans [TaxId: 243230]}
laytlpqlpyaydalephidartmeihhtkhhqtyvdnankalegtefadlpveqliqql
drvpadkkgalrnnagghanhsmfwqim

Timeline for d2ce4b1:

• d2ce4b1 first appeared in SCOPe 2.03
  
• d2ce4b1 appears in SCOPe 2.07