Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) |
Protein automated matches [226880] (2 species) not a true protein |
Species Deinococcus radiodurans [TaxId:243230] [225053] (2 PDB entries) |
Domain d2ce4a2: 2ce4 A:99-210 [203779] Other proteins in same PDB: d2ce4a1, d2ce4b1 automated match to d1y67a2 complexed with mn |
PDB Entry: 2ce4 (more details), 2.2 Å
SCOPe Domain Sequences for d2ce4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ce4a2 d.44.1.1 (A:99-210) automated matches {Deinococcus radiodurans [TaxId: 243230]} psgelldainsafgsfdafkqkfedaaktrfgsgwawlvvkdgkldvvstanqdnplmge aiagvsgtpilgvdvwehayylnyqnrrpdylaafwnvvnwdevskryaaak
Timeline for d2ce4a2: