Lineage for d2ce4a1 (2ce4 A:1-87)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690049Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2690339Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2690340Protein automated matches [226859] (39 species)
    not a true protein
  7. 2690422Species Deinococcus radiodurans [TaxId:243230] [225052] (2 PDB entries)
  8. 2690427Domain d2ce4a1: 2ce4 A:1-87 [203778]
    Other proteins in same PDB: d2ce4a2, d2ce4b2
    automated match to d1y67a1
    complexed with mn

Details for d2ce4a1

PDB Entry: 2ce4 (more details), 2.2 Å

PDB Description: manganese superoxide dismutase (mn-sod) from deinococcus radiodurans
PDB Compounds: (A:) Superoxide dismutase [Mn]

SCOPe Domain Sequences for d2ce4a1:

Sequence, based on SEQRES records: (download)

>d2ce4a1 a.2.11.0 (A:1-87) automated matches {Deinococcus radiodurans [TaxId: 243230]}
aytlpqlpyaydalephidartmeihhtkhhqtyvdnankalegtefadlpveqliqqld
rvpadkkgalrnnagghanhsmfwqim

Sequence, based on observed residues (ATOM records): (download)

>d2ce4a1 a.2.11.0 (A:1-87) automated matches {Deinococcus radiodurans [TaxId: 243230]}
aytlpqlpyaydalephidartmeihhtkhhqtyvdnankaletefadlpveqliqqldr
vpadkkgalrnnagghanhsmfwqim

SCOPe Domain Coordinates for d2ce4a1:

Click to download the PDB-style file with coordinates for d2ce4a1.
(The format of our PDB-style files is described here.)

Timeline for d2ce4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ce4a2