Lineage for d2cdyb1 (2cdy B:-2-87)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1476004Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1476277Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 1476544Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 1476545Protein automated matches [226859] (26 species)
    not a true protein
  7. 1476599Species Deinococcus radiodurans [TaxId:243230] [225052] (2 PDB entries)
  8. 1476601Domain d2cdyb1: 2cdy B:-2-87 [203772]
    Other proteins in same PDB: d2cdya2, d2cdyb2, d2cdyc2, d2cdyd2
    automated match to d1y67a1
    complexed with mn

Details for d2cdyb1

PDB Entry: 2cdy (more details), 2 Å

PDB Description: manganese superoxide dismutase (mn-sod) from deinococcus radiodurans
PDB Compounds: (B:) Superoxide dismutase [Mn]

SCOPe Domain Sequences for d2cdyb1:

Sequence, based on SEQRES records: (download)

>d2cdyb1 a.2.11.0 (B:-2-87) automated matches {Deinococcus radiodurans [TaxId: 243230]}
alaytlpqlpyaydalephidartmeihhtkhhqtyvdnankalegtefadlpveqliqq
ldrvpadkkgalrnnagghanhsmfwqim

Sequence, based on observed residues (ATOM records): (download)

>d2cdyb1 a.2.11.0 (B:-2-87) automated matches {Deinococcus radiodurans [TaxId: 243230]}
alaytlpqlpyaydalephidartmeihhtkhhqtyvdnankaleefadlpveqliqqld
rvpadkkgalrnnagghanhsmfwqim

SCOPe Domain Coordinates for d2cdyb1:

Click to download the PDB-style file with coordinates for d2cdyb1.
(The format of our PDB-style files is described here.)

Timeline for d2cdyb1: