SCOP 1.63: Domain d3fctd1: 3fct D:1-114

Lineage for d3fctd1 (3fct D:1-114)

Root: SCOP 1.63
Class b: All beta proteins [48724] (119 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
Species Metal chelatase catalytic Fab 7G12, (human), kappa L chain [48879] (5 PDB entries)
Domain d3fctd1: 3fct D:1-114 [20377]
Other proteins in same PDB: d3fcta2, d3fctb2, d3fctc2, d3fctd2
mature antibody
complexed with ca, cd, mg, mmp, na

Details for d3fctd1

PDB Entry: 3fct (more details), 2.4 Å

PDB Description: mature metal chelatase catalytic antibody with hapten

SCOP Domain Sequences for d3fctd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fctd1 b.1.1.1 (D:1-114) Immunoglobulin (variable domains of L and H chains) {Metal chelatase catalytic Fab 7G12, (human), kappa L chain}
qvqllesgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigmidpnsggtky
nekfkskatltvdkpsntaymqlssltsedsavyyctrrdmdywgagttvtvss

SCOP Domain Coordinates for d3fctd1:

Click to download the PDB-style file with coordinates for d3fctd1.
(The format of our PDB-style files is described here.)

Timeline for d3fctd1: