Lineage for d3fctd1 (3fct D:1-114)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 8006Species Mature metal chelatase catalytic Fab, (human), kappa L chain [48879] (1 PDB entry)
  8. 8010Domain d3fctd1: 3fct D:1-114 [20377]
    Other proteins in same PDB: d3fcta2, d3fctb2, d3fctc2, d3fctd2

Details for d3fctd1

PDB Entry: 3fct (more details), 2.4 Å

PDB Description: mature metal chelatase catalytic antibody with hapten

SCOP Domain Sequences for d3fctd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fctd1 b.1.1.1 (D:1-114) Immunoglobulin (variable domains of L and H chains) {Mature metal chelatase catalytic Fab, (human), kappa L chain}
qvqllesgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigmidpnsggtky
nekfkskatltvdkpsntaymqlssltsedsavyyctrrdmdywgagttvtvss

SCOP Domain Coordinates for d3fctd1:

Click to download the PDB-style file with coordinates for d3fctd1.
(The format of our PDB-style files is described here.)

Timeline for d3fctd1: