![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
![]() | Species Mature metal chelatase catalytic Fab, (human), kappa L chain [48879] (1 PDB entry) |
![]() | Domain d3fctd1: 3fct D:1-114 [20377] Other proteins in same PDB: d3fcta2, d3fctb2, d3fctc2, d3fctd2 |
PDB Entry: 3fct (more details), 2.4 Å
SCOP Domain Sequences for d3fctd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fctd1 b.1.1.1 (D:1-114) Immunoglobulin (variable domains of L and H chains) {Mature metal chelatase catalytic Fab, (human), kappa L chain} qvqllesgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigmidpnsggtky nekfkskatltvdkpsntaymqlssltsedsavyyctrrdmdywgagttvtvss
Timeline for d3fctd1: