SCOP 1.61: Domain d3fctc1: 3fct C:1-107

Lineage for d3fctc1 (3fct C:1-107)

Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
Superfamily b.1.1: Immunoglobulin [48726] (6 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
Species Mature metal chelatase catalytic Fab, (human), kappa L chain [48879] (1 PDB entry)
Domain d3fctc1: 3fct C:1-107 [20376]
Other proteins in same PDB: d3fcta2, d3fctb2, d3fctc2, d3fctd2

Details for d3fctc1

PDB Entry: 3fct (more details), 2.4 Å

PDB Description: mature metal chelatase catalytic antibody with hapten

SCOP Domain Sequences for d3fctc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fctc1 b.1.1.1 (C:1-107) Immunoglobulin (variable domains of L and H chains) {Mature metal chelatase catalytic Fab, (human), kappa L chain}
elvmtqtpkfmsttvgdrvsitckasqnvgtpvawyqqkpgqspklliysasnrytgvpd
rftgsgsgtdftltisnmqsedladyfcqqyssypltfgggtkveik

SCOP Domain Coordinates for d3fctc1:

Click to download the PDB-style file with coordinates for d3fctc1.
(The format of our PDB-style files is described here.)

Timeline for d3fctc1: