Lineage for d2cbza1 (2cbz A:642-871)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2128604Species Human (Homo sapiens) [TaxId:9606] [186862] (124 PDB entries)
  8. 2128610Domain d2cbza1: 2cbz A:642-871 [203759]
    Other proteins in same PDB: d2cbza2
    automated match to d1mv5d_
    complexed with atp, mg

Details for d2cbza1

PDB Entry: 2cbz (more details), 1.5 Å

PDB Description: structure of the human multidrug resistance protein 1 nucleotide binding domain 1
PDB Compounds: (A:) multidrug resistance-associated protein 1

SCOPe Domain Sequences for d2cbza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cbza1 c.37.1.0 (A:642-871) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nsitvrnatftwarsdpptlngitfsipegalvavvgqvgcgkssllsallaemdkvegh
vaikgsvayvpqqawiqndslrenilfgcqleepyyrsviqacallpdleilpsgdrtei
gekgvnlsggqkqrvslaravysnadiylfddplsavdahvgkhifenvigpkgmlknkt
rilvthsmsylpqvdviivmsggkisemgsyqellardgafaeflrtyas

SCOPe Domain Coordinates for d2cbza1:

Click to download the PDB-style file with coordinates for d2cbza1.
(The format of our PDB-style files is described here.)

Timeline for d2cbza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cbza2