Lineage for d2cb9a_ (2cb9 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152713Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2152714Protein automated matches [190543] (91 species)
    not a true protein
  7. 2152776Species Bacillus subtilis [TaxId:1423] [225226] (4 PDB entries)
  8. 2152777Domain d2cb9a_: 2cb9 A: [203757]
    automated match to d1jmkc_
    complexed with acy

Details for d2cb9a_

PDB Entry: 2cb9 (more details), 1.8 Å

PDB Description: crystal structure of the thioesterase domain of the fengycin biosynthesis cluster
PDB Compounds: (A:) fengycin synthetase

SCOPe Domain Sequences for d2cb9a_:

Sequence, based on SEQRES records: (download)

>d2cb9a_ c.69.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
saageqhviqlnqqggknlfcfppisgfgiyfkdlalqlnhkaavygfhfieedsrieqy
vsriteiqpegpyvllgysaggnlafevvqameqkglevsdfiivdaykkdqsitadten
ddsaaylpeavretvmqkkrcyqeywaqlinegriksnihfieagiqtetsgamvlqkwq
daaeegyaeytgygahkdmlegefaeknaniilnildki

Sequence, based on observed residues (ATOM records): (download)

>d2cb9a_ c.69.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
saageqhviqlnqqggknlfcfppisgfgiyfkdlalqlnhkaavygfhfieedsrieqy
vsriteiqpegpyvllgysaggnlafevvqameqkglevsdfiivdaykkdqsitadayl
peavretvmqkkrcyqeywaqlinegriksnihfieagiqtetsgamvlqkwqdaaeegy
aeytgygahkdmlegefaeknaniilnildki

SCOPe Domain Coordinates for d2cb9a_:

Click to download the PDB-style file with coordinates for d2cb9a_.
(The format of our PDB-style files is described here.)

Timeline for d2cb9a_: