Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (45 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224964] (6 PDB entries) |
Domain d2c9ha2: 2c9h A:282-444 [203756] automated match to d2alma2 complexed with ni |
PDB Entry: 2c9h (more details), 1.8 Å
SCOPe Domain Sequences for d2c9ha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c9ha2 c.95.1.0 (A:282-444) automated matches {Human (Homo sapiens) [TaxId: 9606]} riyaevlgyglsgdaghitapdpegegalrcmaaalkdagvqpeeisyinahatstplgd aaenkaikhlfkdhayalavsstkgatghllgaagaveaafttlacyyqklpptlnldcs epefdlnyvplkaqewktekrfigltnsfgfggtnatlciagl
Timeline for d2c9ha2: