SCOPe 2.04: Domain d2c9ha2: 2c9h A:282-444

Lineage for d2c9ha2 (2c9h A:282-444)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (45 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224964] (6 PDB entries)

8. Domain d2c9ha2: 2c9h A:282-444 [203756]
   automated match to d2alma2
   complexed with ni

Details for d2c9ha2

PDB Entry: 2c9h, 1.8 Å

PDB Description: structure of mitochondrial beta-ketoacyl synthase

PDB Compounds: (A:) mitochondrial beta-ketoacyl synthase

SCOPe Domain Sequences for d2c9ha2:

Sequence; same for both SEQRES and ATOM records:

>d2c9ha2 c.95.1.0 (A:282-444) automated matches {Human (Homo sapiens) [TaxId: 9606]}
riyaevlgyglsgdaghitapdpegegalrcmaaalkdagvqpeeisyinahatstplgd
aaenkaikhlfkdhayalavsstkgatghllgaagaveaafttlacyyqklpptlnldcs
epefdlnyvplkaqewktekrfigltnsfgfggtnatlciagl

Timeline for d2c9ha2:

• d2c9ha2 first appeared in SCOPe 2.03
  
• d2c9ha2 appears in SCOPe 2.05
  
• d2c9ha2 appears in the current release, SCOPe 2.08