![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.7: Metal cation-transporting ATPase, actuator domain A [81653] (1 family) ![]() a distorted variant of double-helix |
![]() | Family b.82.7.1: Metal cation-transporting ATPase, actuator domain A [81652] (2 proteins) |
![]() | Protein Calcium ATPase, transduction domain A [81651] (1 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (42 PDB entries) Uniprot P04191 |
![]() | Domain d2c8ka2: 2c8k A:125-239 [203752] Other proteins in same PDB: d2c8ka1, d2c8ka3, d2c8ka4 automated match to d1wpga1 complexed with acp, mg, na, tg1 |
PDB Entry: 2c8k (more details), 2.8 Å
SCOPe Domain Sequences for d2c8ka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c8ka2 b.82.7.1 (A:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm
Timeline for d2c8ka2: