![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
![]() | Protein automated matches [196909] (83 species) not a true protein |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225073] (3 PDB entries) |
![]() | Domain d2c7za2: 2c7z A:312-441 [203750] automated match to d1afwa2 |
PDB Entry: 2c7z (more details), 2.37 Å
SCOPe Domain Sequences for d2c7za2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c7za2 c.95.1.0 (A:312-441) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} kglpvlgvfrtfaavgvdpaimgigpavaipaavkaaglelddidlfeineafasqfvyc rnklgldpekinvnggamaighplgatgarcvatllhemkrrgkdcrfgvvsmcigtgmg aaavfergdg
Timeline for d2c7za2: