SCOP 1.73: Domain d3fctb1: 3fct B:1-114

Lineage for d3fctb1 (3fct B:1-114)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)

8. Domain d3fctb1: 3fct B:1-114 [20375]
   Other proteins in same PDB: d3fcta1, d3fcta2, d3fctb2, d3fctc1, d3fctc2, d3fctd2

Details for d3fctb1

PDB Entry: 3fct, 2.4 Å

PDB Description: mature metal chelatase catalytic antibody with hapten

PDB Compounds: (B:) protein (metal chelatase catalytic antibody)

SCOP Domain Sequences for d3fctb1:

Sequence; same for both SEQRES and ATOM records:

>d3fctb1 b.1.1.1 (B:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qvqllesgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigmidpnsggtky
nekfkskatltvdkpsntaymqlssltsedsavyyctrrdmdywgagttvtvss

Timeline for d3fctb1:

• d3fctb1 first appeared (with stable ids) in SCOP 1.55
  
• d3fctb1 appears in SCOP 1.71
  
• d3fctb1 appears in SCOP 1.75
  
• d3fctb1 appears in the current release, SCOPe 2.08