Lineage for d2c7ya1 (2c7y A:38-311)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2146372Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2146373Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2147118Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2147119Protein automated matches [196909] (58 species)
    not a true protein
  7. 2147707Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225073] (3 PDB entries)
  8. 2147712Domain d2c7ya1: 2c7y A:38-311 [203745]
    automated match to d1afwa1

Details for d2c7ya1

PDB Entry: 2c7y (more details), 2.1 Å

PDB Description: plant enzyme
PDB Compounds: (A:) 3-ketoacyl-coa thiolase 2

SCOPe Domain Sequences for d2c7ya1:

Sequence, based on SEQRES records: (download)

>d2c7ya1 c.95.1.0 (A:38-311) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
dsaayqrtslygddvvivaahrtplckskrgnfkdtypddllapvlraliektnlnpsev
gdivvgtvlapgsqrasecrmaafyagfpetvavrtvnrqcssglqavadvaaaikagfy
digigaglesmttnpmawegsvnpavkkfaqaqncllpmgvtsenvaqrfgvsrqeqdqa
avdshrkaaaataagkfkdeiipvktklvdpktgdekpitvsvddgirptttlaslgklk
pvfkkdgtttagnssqvsdgagavllmkrsvamq

Sequence, based on observed residues (ATOM records): (download)

>d2c7ya1 c.95.1.0 (A:38-311) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
dsaayqrtslygddvvivaahrtplckskrgnfkdtypddllapvlraliektnlnpsev
gdivvgtvlapgsqrasecrmaafyagfpetvavrtvnrqcssglqavadvaaaikagfy
digigaglesmttnpkfaqaqncllpmgvtsenvaqrfgvsrqeqdqaavdshrkaaaat
aagkfkdeiipvktklvdpktgdekpitvsvddgirptttlaslgklkpvfkkdgtttag
nssqvsdgagavllmkrsvamq

SCOPe Domain Coordinates for d2c7ya1:

Click to download the PDB-style file with coordinates for d2c7ya1.
(The format of our PDB-style files is described here.)

Timeline for d2c7ya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c7ya2