Lineage for d2c3qa1 (2c3q A:2-79)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1854430Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1854431Protein automated matches [190056] (147 species)
    not a true protein
  7. 1854913Species Human (Homo sapiens) [TaxId:9606] [188013] (102 PDB entries)
  8. 1855012Domain d2c3qa1: 2c3q A:2-79 [203724]
    Other proteins in same PDB: d2c3qa2, d2c3qb2, d2c3qc2, d2c3qd2
    automated match to d2ljra2
    complexed with gtx, iod; mutant

Details for d2c3qa1

PDB Entry: 2c3q (more details), 1.85 Å

PDB Description: human glutathione-s-transferase t1-1 w234r mutant, complex with s- hexylglutathione
PDB Compounds: (A:) glutathione s-transferase theta 1

SCOPe Domain Sequences for d2c3qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c3qa1 c.47.1.0 (A:2-79) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glelyldllsqpcravyifakkndipfelrivdlikgqhlsdafaqvnplkkvpalkdgd
ftltesvaillyltrkyk

SCOPe Domain Coordinates for d2c3qa1:

Click to download the PDB-style file with coordinates for d2c3qa1.
(The format of our PDB-style files is described here.)

Timeline for d2c3qa1: