Lineage for d2c3nd1 (2c3n D:2-79)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486890Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2486891Protein automated matches [190056] (188 species)
    not a true protein
  7. 2487517Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)
  8. 2487532Domain d2c3nd1: 2c3n D:2-79 [203722]
    Other proteins in same PDB: d2c3na2, d2c3nb2, d2c3nc2, d2c3nd2
    automated match to d2ljra2
    complexed with iod

Details for d2c3nd1

PDB Entry: 2c3n (more details), 1.5 Å

PDB Description: human glutathione-s-transferase t1-1, apo form
PDB Compounds: (D:) glutathione s-transferase theta 1

SCOPe Domain Sequences for d2c3nd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c3nd1 c.47.1.0 (D:2-79) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glelyldllsqpcravyifakkndipfelrivdlikgqhlsdafaqvnplkkvpalkdgd
ftltesvaillyltrkyk

SCOPe Domain Coordinates for d2c3nd1:

Click to download the PDB-style file with coordinates for d2c3nd1.
(The format of our PDB-style files is described here.)

Timeline for d2c3nd1: