| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries) |
| Domain d2c3nd1: 2c3n D:2-79 [203722] Other proteins in same PDB: d2c3na2, d2c3nb2, d2c3nc2, d2c3nd2 automated match to d2ljra2 complexed with iod |
PDB Entry: 2c3n (more details), 1.5 Å
SCOPe Domain Sequences for d2c3nd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c3nd1 c.47.1.0 (D:2-79) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glelyldllsqpcravyifakkndipfelrivdlikgqhlsdafaqvnplkkvpalkdgd
ftltesvaillyltrkyk
Timeline for d2c3nd1: