Lineage for d2c3nc2 (2c3n C:80-240)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714013Species Human (Homo sapiens) [TaxId:9606] [225003] (13 PDB entries)
  8. 2714022Domain d2c3nc2: 2c3n C:80-240 [203721]
    Other proteins in same PDB: d2c3na1, d2c3nb1, d2c3nc1, d2c3nd1
    automated match to d2ljra1
    complexed with iod

Details for d2c3nc2

PDB Entry: 2c3n (more details), 1.5 Å

PDB Description: human glutathione-s-transferase t1-1, apo form
PDB Compounds: (C:) glutathione s-transferase theta 1

SCOPe Domain Sequences for d2c3nc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c3nc2 a.45.1.0 (C:80-240) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpdywypqdlqararvdeylawqhttlrrsclralwhkvmfpvflgepvspqtlaatlae
ldvtlqlledkflqnkafltgphisladlvaitelmhpvgagcqvfegrpklatwrqrve
aavgedlfqeahevilkakdfppadptikqklmpwvlamir

SCOPe Domain Coordinates for d2c3nc2:

Click to download the PDB-style file with coordinates for d2c3nc2.
(The format of our PDB-style files is described here.)

Timeline for d2c3nc2: