SCOPe 2.08: Domain d2c3nc2: 2c3n C:80-240

Lineage for d2c3nc2 (2c3n C:80-240)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225003] (13 PDB entries)

8. Domain d2c3nc2: 2c3n C:80-240 [203721]
   Other proteins in same PDB: d2c3na1, d2c3nb1, d2c3nc1, d2c3nd1
   automated match to d2ljra1
   complexed with iod

Details for d2c3nc2

PDB Entry: 2c3n, 1.5 Å

PDB Description: human glutathione-s-transferase t1-1, apo form

PDB Compounds: (C:) glutathione s-transferase theta 1

SCOPe Domain Sequences for d2c3nc2:

Sequence; same for both SEQRES and ATOM records:

>d2c3nc2 a.45.1.0 (C:80-240) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpdywypqdlqararvdeylawqhttlrrsclralwhkvmfpvflgepvspqtlaatlae
ldvtlqlledkflqnkafltgphisladlvaitelmhpvgagcqvfegrpklatwrqrve
aavgedlfqeahevilkakdfppadptikqklmpwvlamir

Timeline for d2c3nc2:

• d2c3nc2 first appeared in SCOPe 2.03
  
• d2c3nc2 appears in SCOPe 2.07