![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins) |
![]() | Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species) VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species |
![]() | Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (126 PDB entries) |
![]() | Domain d2pcpc1: 2pcp C:1-107 [20372] Other proteins in same PDB: d2pcpa2, d2pcpb1, d2pcpb2, d2pcpc2, d2pcpd1, d2pcpd2 part of Fab 6B5 complexed with 1pc |
PDB Entry: 2pcp (more details), 2.2 Å
SCOP Domain Sequences for d2pcpc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pcpc1 b.1.1.1 (C:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1} dvlmtqtplslpvslgdqasiscrssqtivhsngntylewylqkpgqspklliykvtnrf sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgthapytfgggtkleik
Timeline for d2pcpc1: