| Class b: All beta proteins [48724] (93 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
| Species Fab 6B5, (mouse), kappa L chain [48878] (1 PDB entry) |
| Domain d2pcpc1: 2pcp C:1-107 [20372] Other proteins in same PDB: d2pcpa2, d2pcpb2, d2pcpc2, d2pcpd2 |
PDB Entry: 2pcp (more details), 2.2 Å
SCOP Domain Sequences for d2pcpc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pcpc1 b.1.1.1 (C:1-107) Immunoglobulin (variable domains of L and H chains) {Fab 6B5, (mouse), kappa L chain}
dvlmtqtplslpvslgdqasiscrssqtivhsngntylewylqkpgqspklliykvtnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgthapytfgggtkleik
Timeline for d2pcpc1: