SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2c3nb2 (2c3n B:80-240)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996612Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1996613Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1997413Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 1997414Protein automated matches [226831] (57 species)
    not a true protein
  7. 1997581Species Human (Homo sapiens) [TaxId:9606] [225003] (11 PDB entries)
  8. 1997585Domain d2c3nb2: 2c3n B:80-240 [203719]
    Other proteins in same PDB: d2c3na1, d2c3nb1, d2c3nc1, d2c3nd1
    automated match to d2ljra1
    complexed with iod

Details for d2c3nb2

PDB Entry: 2c3n (more details), 1.5 Å

PDB Description: human glutathione-s-transferase t1-1, apo form
PDB Compounds: (B:) glutathione s-transferase theta 1

SCOPe Domain Sequences for d2c3nb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c3nb2 a.45.1.0 (B:80-240) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpdywypqdlqararvdeylawqhttlrrsclralwhkvmfpvflgepvspqtlaatlae
ldvtlqlledkflqnkafltgphisladlvaitelmhpvgagcqvfegrpklatwrqrve
aavgedlfqeahevilkakdfppadptikqklmpwvlamir

SCOPe Domain Coordinates for d2c3nb2:

Click to download the PDB-style file with coordinates for d2c3nb2.
(The format of our PDB-style files is described here.)

Timeline for d2c3nb2: