SCOP 1.71: Domain d2pcpb1: 2pcp B:1-113

Lineage for d2pcpb1 (2pcp B:1-113)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)

8. Domain d2pcpb1: 2pcp B:1-113 [20371]
   Other proteins in same PDB: d2pcpa1, d2pcpa2, d2pcpb2, d2pcpc1, d2pcpc2, d2pcpd2

Details for d2pcpb1

PDB Entry: 2pcp, 2.2 Å

PDB Description: antibody fab complexed with phencyclidine

SCOP Domain Sequences for d2pcpb1:

Sequence; same for both SEQRES and ATOM records:

>d2pcpb1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
evqlqqsgpelvkpgasvkmsckasgytftdyyihwnkqshgkslewigyiypnnggngy
nhkfkgkatltvdkssstaymdvrtltsedsavyycgrstwddfdywgqgttltvss

Timeline for d2pcpb1:

• d2pcpb1 first appeared (with stable ids) in SCOP 1.55
  
• d2pcpb1 appears in SCOP 1.69
  
• d2pcpb1 appears in SCOP 1.73
  
• d2pcpb1 appears in the current release, SCOPe 2.08