Lineage for d2c2xa1 (2c2x A:2-121)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890629Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2890630Protein automated matches [226864] (40 species)
    not a true protein
  7. 2890804Species Mycobacterium tuberculosis [TaxId:83332] [225030] (2 PDB entries)
  8. 2890805Domain d2c2xa1: 2c2x A:2-121 [203709]
    Other proteins in same PDB: d2c2xa2, d2c2xb2
    automated match to d1a4ia2

Details for d2c2xa1

PDB Entry: 2c2x (more details), 2 Å

PDB Description: three dimensional structure of bifunctional methylenetetrahydrofolate dehydrogenase-cyclohydrolase from mycobacterium tuberculosis
PDB Compounds: (A:) methylenetetrahydrofolate dehydrogenase-methenyltetrahydrofolate cyclohydrolase

SCOPe Domain Sequences for d2c2xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c2xa1 c.58.1.0 (A:2-121) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
gaimldgkatrdeifgdlkqrvaaldaagrtpglgtilvgddpgsqayvrgkhadcakvg
itsirrdlpadistatlnetidelnanpdctgyivqlplpkhldenaalervdpakdadg

SCOPe Domain Coordinates for d2c2xa1:

Click to download the PDB-style file with coordinates for d2c2xa1.
(The format of our PDB-style files is described here.)

Timeline for d2c2xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c2xa2