Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (181 species) not a true protein |
Species Bacillus anthracis [TaxId:198094] [189998] (3 PDB entries) |
Domain d2c20d_: 2c20 D: [203706] automated match to d3enkb_ complexed with nad, zn |
PDB Entry: 2c20 (more details), 2.7 Å
SCOPe Domain Sequences for d2c20d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c20d_ c.2.1.0 (D:) automated matches {Bacillus anthracis [TaxId: 198094]} nsilicggagyigshavkklvdeglsvvvvdnlqtghedaitegakfyngdlrdkaflrd vftqenieavmhfaadslvgvsmekplqyynnnvygalcllevmdefkvdkfifsstaat ygevdvdliteetmtnptntygetklaiekmlhwysqasnlrykifryfnvagatpngii gedhrpethliplvlqvalgqrekimmfgddyntpdgtcirdyihvedlvaahflglkdl qnggesdfynlgngngfsvkeivdavrevtnheipaevaprragdparlvassqkakekl gwdpryvnvktiiehawnwhqkqpngyek
Timeline for d2c20d_: