| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
| Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
| Protein automated matches [190453] (26 species) not a true protein |
| Species Paracoccus pantotrophus [TaxId:82367] [187503] (3 PDB entries) |
| Domain d2c1va2: 2c1v A:181-338 [203700] automated match to d1nmla2 complexed with ca, edo, hec |
PDB Entry: 2c1v (more details), 1.2 Å
SCOPe Domain Sequences for d2c1va2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c1va2 a.3.1.0 (A:181-338) automated matches {Paracoccus pantotrophus [TaxId: 82367]}
nsafdrflagddaamtdqekrglqafmetgctachygvnfggqdyhpfgliakpgaevlp
agdtgrfevtrttddeyvfraaplrnvaltapyfhsgvvwelaeavkimssaqigteltd
qqaeditaflgtltgeqpvidhpilpvrtgttplptpm
Timeline for d2c1va2: