Lineage for d2pcpa1 (2pcp A:1-107)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219520Species Fab 6B5, (mouse), kappa L chain [48878] (1 PDB entry)
  8. 219521Domain d2pcpa1: 2pcp A:1-107 [20370]
    Other proteins in same PDB: d2pcpa2, d2pcpb2, d2pcpc2, d2pcpd2

Details for d2pcpa1

PDB Entry: 2pcp (more details), 2.2 Å

PDB Description: antibody fab complexed with phencyclidine

SCOP Domain Sequences for d2pcpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pcpa1 b.1.1.1 (A:1-107) Immunoglobulin (variable domains of L and H chains) {Fab 6B5, (mouse), kappa L chain}
dvlmtqtplslpvslgdqasiscrssqtivhsngntylewylqkpgqspklliykvtnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgthapytfgggtkleik

SCOP Domain Coordinates for d2pcpa1:

Click to download the PDB-style file with coordinates for d2pcpa1.
(The format of our PDB-style files is described here.)

Timeline for d2pcpa1: