| Class b: All beta proteins [48724] (119 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
| Species Fab 6B5, (mouse), kappa L chain [48878] (1 PDB entry) |
| Domain d2pcpa1: 2pcp A:1-107 [20370] Other proteins in same PDB: d2pcpa2, d2pcpb2, d2pcpc2, d2pcpd2 |
PDB Entry: 2pcp (more details), 2.2 Å
SCOP Domain Sequences for d2pcpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pcpa1 b.1.1.1 (A:1-107) Immunoglobulin (variable domains of L and H chains) {Fab 6B5, (mouse), kappa L chain}
dvlmtqtplslpvslgdqasiscrssqtivhsngntylewylqkpgqspklliykvtnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgthapytfgggtkleik
Timeline for d2pcpa1: