Lineage for d2c1uc2 (2c1u C:181-338)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980705Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980706Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1981426Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 1981427Protein automated matches [190453] (22 species)
    not a true protein
  7. 1981496Species Paracoccus pantotrophus [TaxId:82367] [187503] (3 PDB entries)
  8. 1981510Domain d2c1uc2: 2c1u C:181-338 [203696]
    automated match to d1nmla2
    complexed with ca, hec

Details for d2c1uc2

PDB Entry: 2c1u (more details), 1.95 Å

PDB Description: crystal structure of the di-haem cytochrome c peroxidase from paracoccus pantotrophus - oxidised form
PDB Compounds: (C:) di-haem cytochrome c peroxidase

SCOPe Domain Sequences for d2c1uc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c1uc2 a.3.1.0 (C:181-338) automated matches {Paracoccus pantotrophus [TaxId: 82367]}
nsafdrflagddaamtdqekrglqafmetgctachygvnfggqdyhpfgliakpgaevlp
agdtgrfevtrttddeyvfraaplrnvaltapyfhsgvvwelaeavkimssaqigteltd
qqaeditaflgtltgeqpvidhpilpvrtgttplptpm

SCOPe Domain Coordinates for d2c1uc2:

Click to download the PDB-style file with coordinates for d2c1uc2.
(The format of our PDB-style files is described here.)

Timeline for d2c1uc2: