Class a: All alpha proteins [46456] (289 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
Protein automated matches [190453] (22 species) not a true protein |
Species Paracoccus pantotrophus [TaxId:82367] [187503] (3 PDB entries) |
Domain d2c1uc2: 2c1u C:181-338 [203696] automated match to d1nmla2 complexed with ca, hec |
PDB Entry: 2c1u (more details), 1.95 Å
SCOPe Domain Sequences for d2c1uc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c1uc2 a.3.1.0 (C:181-338) automated matches {Paracoccus pantotrophus [TaxId: 82367]} nsafdrflagddaamtdqekrglqafmetgctachygvnfggqdyhpfgliakpgaevlp agdtgrfevtrttddeyvfraaplrnvaltapyfhsgvvwelaeavkimssaqigteltd qqaeditaflgtltgeqpvidhpilpvrtgttplptpm
Timeline for d2c1uc2: