Lineage for d1sm3h1 (1sm3 H:1-113)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 929498Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 929756Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (46 PDB entries)
    Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4
  8. 929776Domain d1sm3h1: 1sm3 H:1-113 [20369]
    Other proteins in same PDB: d1sm3h2, d1sm3l1, d1sm3l2
    part of tumor-specific Fab SM3 against epithelial mucin Muc1
    complexed with cd, cl

Details for d1sm3h1

PDB Entry: 1sm3 (more details), 1.95 Å

PDB Description: crystal structure of the tumor specific antibody sm3 complex with its peptide epitope
PDB Compounds: (H:) sm3 antibody

SCOPe Domain Sequences for d1sm3h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sm3h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
qvqlqesggglvqpggsmklscvasgftfsnywmnwvrqspekglewvaeirlksnnyat
hyaesvkgrftisrddskssvylqmnnlraedtgiyyctgvgqfaywgqgttvtvss

SCOPe Domain Coordinates for d1sm3h1:

Click to download the PDB-style file with coordinates for d1sm3h1.
(The format of our PDB-style files is described here.)

Timeline for d1sm3h1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sm3h2