SCOP 1.59: Domain d1sm3h1: 1sm3 H:1-113

Lineage for d1sm3h1 (1sm3 H:1-113)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Tumor-specific Fab SM3, (mouse), lambda L chain [48877] (1 PDB entry)

8. Domain d1sm3h1: 1sm3 H:1-113 [20369]
   Other proteins in same PDB: d1sm3h2, d1sm3l2

Details for d1sm3h1

PDB Entry: 1sm3, 1.95 Å

PDB Description: crystal structure of the tumor specific antibody sm3 complex with its peptide epitope

SCOP Domain Sequences for d1sm3h1:

Sequence; same for both SEQRES and ATOM records:

>d1sm3h1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Tumor-specific Fab SM3, (mouse), lambda L chain}
qvqlqesggglvqpggsmklscvasgftfsnywmnwvrqspekglewvaeirlksnnyat
hyaesvkgrftisrddskssvylqmnnlraedtgiyyctgvgqfaywgqgttvtvss

Timeline for d1sm3h1:

• d1sm3h1 first appeared (with stable ids) in SCOP 1.55
  
• d1sm3h1 appears in SCOP 1.57
  
• d1sm3h1 appears in SCOP 1.61
  
• d1sm3h1 appears in the current release, SCOPe 2.08