SCOPe 2.08: Domain d2c1pa1: 2c1p A:1-107

Lineage for d2c1pa1 (2c1p A:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d2c1pa1: 2c1p A:1-107 [203687]
   Other proteins in same PDB: d2c1pa2, d2c1pb_, d2c1ph_, d2c1pl2
   automated match to d2fatl1
   complexed with fnz

Details for d2c1pa1

PDB Entry: 2c1p, 2 Å

PDB Description: fab-fragment of enantioselective antibody complexed with finrozole

PDB Compounds: (A:) igk-c protein

SCOPe Domain Sequences for d2c1pa1:

Sequence; same for both SEQRES and ATOM records:

>d2c1pa1 b.1.1.0 (A:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
elvmtqspltlsvtigqpasisckssqsllysngktylnwllqrpgqspkrliylvskld
sgdpdrftgsgsgtdftlkisrveaedlgiyycvqgshfpptfgagtklelk

Timeline for d2c1pa1:

• d2c1pa1 first appeared in SCOPe 2.03
  
• d2c1pa1 appears in SCOPe 2.07