| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
| Domain d2c1ol1: 2c1o L:1-107 [203685] Other proteins in same PDB: d2c1ob_, d2c1oh_ automated match to d2fatl1 |
PDB Entry: 2c1o (more details), 2.75 Å
SCOPe Domain Sequences for d2c1ol1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c1ol1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
elvmtqspltlsvtigqpasisckssqsllysngktylnwllqrpgqspkrliylvskld
sgdpdrftgsgsgtdftlkisrveaedlgiyycvqgshfpptfgagtklelk
Timeline for d2c1ol1:
View in 3DDomains from other chains: (mouse over for more information) d2c1oa1, d2c1oa2, d2c1ob_, d2c1oh_ |