Lineage for d2c0ya_ (2c0y A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2154579Family d.3.1.1: Papain-like [54002] (26 protein domains)
  6. 2154920Protein automated matches [190264] (11 species)
    not a true protein
  7. 2154939Species Human (Homo sapiens) [TaxId:9606] [187102] (7 PDB entries)
  8. 2154951Domain d2c0ya_: 2c0y A: [203682]
    automated match to d1by8a_
    mutant

Details for d2c0ya_

PDB Entry: 2c0y (more details), 2.1 Å

PDB Description: the crystal structure of a cys25ala mutant of human procathepsin s
PDB Compounds: (A:) procathepsin s

SCOPe Domain Sequences for d2c0ya_:

Sequence, based on SEQRES records: (download)

>d2c0ya_ d.3.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lhkdptldhhwhlwkktygkqykekneeavrrliweknlkfvmlhnlehsmgmhsydlgm
nhlgdmtseevmslmsslrvpsqwqrnityksnpnrilpdsvdwrekgcvtevkyqgscg
aawafsavgaleaqlklktgklvslsaqnlvdcstekygnkgcnggfmttafqyiidnkg
idsdasypykamdqkcqydskyraatcskytelpygredvlkeavankgpvsvgvdarhp
sfflyrsgvyyepsctqnvnhgvlvvgygdlngkeywlvknswghnfgeegyirmarnkg
nhcgiasfpsypei

Sequence, based on observed residues (ATOM records): (download)

>d2c0ya_ d.3.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lhkdptldhhwhlwkktygkqykekneeavrrliweknlkfvmlhnlehsmgmhsydlgm
nhlgdmtseevmslmsslrvpsqwqrnityilpdsvdwrekgcvtevkyqgscgaawafs
avgaleaqlklktgklvslsaqnlvdcstekygnkgcnggfmttafqyiidnkgidsdas
ypykamdqkcqydskyraatcskytelpygredvlkeavankgpvsvgvdarhpsfflyr
sgvyyepsctqnvnhgvlvvgygdlngkeywlvknswghnfgeegyirmarnkgnhcgia
sfpsypei

SCOPe Domain Coordinates for d2c0ya_:

Click to download the PDB-style file with coordinates for d2c0ya_.
(The format of our PDB-style files is described here.)

Timeline for d2c0ya_: