Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
Species Tumor-specific Fab SM3, (mouse), lambda L chain [48877] (1 PDB entry) against epithelial mucin Muc1 |
Domain d1sm3l1: 1sm3 L:3-107 [20368] Other proteins in same PDB: d1sm3h2, d1sm3l2 |
PDB Entry: 1sm3 (more details), 1.95 Å
SCOP Domain Sequences for d1sm3l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sm3l1 b.1.1.1 (L:3-107) Immunoglobulin (variable domains of L and H chains) {Tumor-specific Fab SM3, (mouse), lambda L chain} ivvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp arfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvlg
Timeline for d1sm3l1: