Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein Hemopoetic cell kinase Hck [55565] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55566] (23 PDB entries) |
Domain d2c0ob2: 2c0o B:121-223 [203674] Other proteins in same PDB: d2c0oa1, d2c0oa3, d2c0oa4, d2c0ob1, d2c0ob3, d2c0ob4 automated match to d1qcfa2 complexed with ca, l2g |
PDB Entry: 2c0o (more details), 2.85 Å
SCOPe Domain Sequences for d2c0ob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c0ob2 d.93.1.1 (B:121-223) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir tldnggfyisprstfstlqelvdhykkgndglcqklsvpcmss
Timeline for d2c0ob2:
View in 3D Domains from other chains: (mouse over for more information) d2c0oa1, d2c0oa2, d2c0oa3, d2c0oa4 |