SCOPe 2.06: Domain d1sbsl1: 1sbs L:1-113

Lineage for d1sbsl1 (1sbs L:1-113)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (51 PDB entries)

8. Domain d1sbsl1: 1sbs L:1-113 [20366]
   Other proteins in same PDB: d1sbsh1, d1sbsh2, d1sbsl2
   part of anti-HCG Fab 3A2
   complexed with so4

Details for d1sbsl1

PDB Entry: 1sbs, 2 Å

PDB Description: crystal structure of an anti-hcg fab

PDB Compounds: (L:) monoclonal antibody 3a2

SCOPe Domain Sequences for d1sbsl1:

Sequence; same for both SEQRES and ATOM records:

>d1sbsl1 b.1.1.1 (L:1-113) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]}
divmsqspsslavsvgekvtmtckssqsllyssnqmnylawyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltissveaedlavyycqqyhsypftfgsgtkleik

Timeline for d1sbsl1:

• d1sbsl1 first appeared (with stable ids) in SCOP 1.55
  
• d1sbsl1 appears in SCOPe 2.05
  
• d1sbsl1 appears in SCOPe 2.07
  
• d1sbsl1 appears in the current release, SCOPe 2.08