SCOP 1.57: Domain d1sbsl1: 1sbs L:1-113

Lineage for d1sbsl1 (1sbs L:1-113)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Anti-HCG Fab 3A2, (mouse), kappa L chain [48876] (1 PDB entry)

8. Domain d1sbsl1: 1sbs L:1-113 [20366]
   Other proteins in same PDB: d1sbsh2, d1sbsl2

Details for d1sbsl1

PDB Entry: 1sbs, 2 Å

PDB Description: crystal structure of an anti-hcg fab

SCOP Domain Sequences for d1sbsl1:

Sequence; same for both SEQRES and ATOM records:

>d1sbsl1 b.1.1.1 (L:1-113) Immunoglobulin (variable domains of L and H chains) {Anti-HCG Fab 3A2, (mouse), kappa L chain}
divmsqspsslavsvgekvtmtckssqsllyssnqmnylawyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltissveaedlavyycqqyhsypftfgsgtkleik

Timeline for d1sbsl1:

• d1sbsl1 first appeared (with stable ids) in SCOP 1.55
  
• d1sbsl1 appears in SCOP 1.59
  
• d1sbsl1 appears in the current release, SCOPe 2.08