Lineage for d2bx5h_ (2bx5 H:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355178Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries)
  8. 2355749Domain d2bx5h_: 2bx5 H: [203647]
    automated match to d1fgvl_

Details for d2bx5h_

PDB Entry: 2bx5 (more details), 2.7 Å

PDB Description: Is FR1 the antibody's Achillies heel
PDB Compounds: (H:) vd9 vki light-chain

SCOPe Domain Sequences for d2bx5h_:

Sequence, based on SEQRES records: (download)

>d2bx5h_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvpsr
fsgsgsgtdftltisslqpedfatyycqqsystpntfgqgtkvei

Sequence, based on observed residues (ATOM records): (download)

>d2bx5h_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvpsr
fsgsgsgtdftltisslqpedfatyycqfgqgtkvei

SCOPe Domain Coordinates for d2bx5h_:

Click to download the PDB-style file with coordinates for d2bx5h_.
(The format of our PDB-style files is described here.)

Timeline for d2bx5h_: