Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (16 species) not a true protein |
Species Escherichia coli [TaxId:562] [225179] (4 PDB entries) |
Domain d2bx5g_: 2bx5 G: [203646] automated match to d1fgvl_ |
PDB Entry: 2bx5 (more details), 2.7 Å
SCOPe Domain Sequences for d2bx5g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bx5g_ b.1.1.1 (G:) automated matches {Escherichia coli [TaxId: 562]} diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps rfsgsgsgtdftltisslqpedfatyycqqsystpntfgqgtkvei
Timeline for d2bx5g_: