Lineage for d1qbml1 (1qbm L:1-107)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652980Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 653521Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (181 PDB entries)
  8. 653629Domain d1qbml1: 1qbm L:1-107 [20364]
    Other proteins in same PDB: d1qbmh1, d1qbmh2, d1qbml2
    part of anti-cytochrome c Fab E8

Details for d1qbml1

PDB Entry: 1qbm (more details), 2.37 Å

PDB Description: fab e8b antibody, x-ray structure at 2.37 angstroms resolution
PDB Compounds: (L:) e8b antibody

SCOP Domain Sequences for d1qbml1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qbml1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
diqmtqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvynaktladgvps
rfsgsgsgtqyslkinslqpedfgsyycqhfwstpwtfgggtkleik

SCOP Domain Coordinates for d1qbml1:

Click to download the PDB-style file with coordinates for d1qbml1.
(The format of our PDB-style files is described here.)

Timeline for d1qbml1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qbml2