SCOPe 2.08: Domain d2bv2b_: 2bv2 B:

Lineage for d2bv2b_ (2bv2 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families)

5. Family b.11.1.0: automated matches [191607] (1 protein)
   not a true family

6. Protein automated matches [191109] (11 species)
   not a true protein

7. Species Ciona intestinalis [TaxId:7719] [225023] (1 PDB entry)

8. Domain d2bv2b_: 2bv2 B: [203639]
   automated match to d1e7na_
   complexed with act, ca, so4

Details for d2bv2b_

PDB Entry: 2bv2, 1.55 Å

PDB Description: beta gamma crystallin from ciona intestinalis

PDB Compounds: (B:) ciona betagamma-crystallin

SCOPe Domain Sequences for d2bv2b_:

Sequence; same for both SEQRES and ATOM records:

>d2bv2b_ b.11.1.0 (B:) automated matches {Ciona intestinalis [TaxId: 7719]}
gkiilfedvefggkkleletsvsdlnvhgfndivssiivesgtwfvfddegfsgpsyklt
pgkypnpgswggnddelssvkqq

Timeline for d2bv2b_:

• d2bv2b_ first appeared in SCOPe 2.03
  
• d2bv2b_ appears in SCOPe 2.07