Lineage for d2bv2a_ (2bv2 A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1304495Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 1304496Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 1304607Family b.11.1.0: automated matches [191607] (1 protein)
    not a true family
  6. 1304608Protein automated matches [191109] (6 species)
    not a true protein
  7. 1304609Species Ciona intestinalis [TaxId:7719] [225023] (1 PDB entry)
  8. 1304610Domain d2bv2a_: 2bv2 A: [203638]
    automated match to d1e7na_
    complexed with act, ca, so4

Details for d2bv2a_

PDB Entry: 2bv2 (more details), 1.55 Å

PDB Description: beta gamma crystallin from ciona intestinalis
PDB Compounds: (A:) ciona betagamma-crystallin

SCOPe Domain Sequences for d2bv2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bv2a_ b.11.1.0 (A:) automated matches {Ciona intestinalis [TaxId: 7719]}
gkiilfedvefggkkleletsvsdlnvhgfndivssiivesgtwfvfddegfsgpsyklt
pgkypnpgswggnddelssvkqq

SCOPe Domain Coordinates for d2bv2a_:

Click to download the PDB-style file with coordinates for d2bv2a_.
(The format of our PDB-style files is described here.)

Timeline for d2bv2a_: