![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily) 3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold |
![]() | Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) ![]() |
![]() | Family d.139.1.0: automated matches [227182] (1 protein) not a true family |
![]() | Protein automated matches [226902] (6 species) not a true protein |
![]() | Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [225123] (1 PDB entry) |
![]() | Domain d2btub2: 2btu B:168-338 [203637] Other proteins in same PDB: d2btua1, d2btub1 automated match to d1clia2 |
PDB Entry: 2btu (more details), 2.31 Å
SCOPe Domain Sequences for d2btub2:
Sequence, based on SEQRES records: (download)
>d2btub2 d.139.1.0 (B:168-338) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} tgekieaghvliglassgihsngyslvrkvlledgelsldriygrlelplgeellkptki yvkpilellknhevygmahitgggfieniprmlpegigaeielgswkiqpifsllqevgk leekemfnifnmgigmvvavkeedakdivrlleeqgetariigrtvqgagv
>d2btub2 d.139.1.0 (B:168-338) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} tgekieaghvliglassgihsngyslvrkvlledgplgeellkptkiyvkpilellknhe vygmahitgggfieniprmlpegigaeielgswkiqpifsllqevgkleekemfnifnmg igmvvavkeedakdivrlleeqgetariigrtvqgagv
Timeline for d2btub2: