SCOPe 2.08: Domain d2btub1: 2btu B:12-167

Lineage for d2btub1 (2btu B:12-167)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families)

5. Family d.79.4.0: automated matches [227181] (1 protein)
   not a true family

6. Protein automated matches [226901] (10 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [225122] (1 PDB entry)

8. Domain d2btub1: 2btu B:12-167 [203636]
   Other proteins in same PDB: d2btua2, d2btub2
   automated match to d1clia1

Details for d2btub1

PDB Entry: 2btu, 2.31 Å

PDB Description: crystal structure of phosphoribosylformylglycinamidine cyclo-ligase from bacillus anthracis at 2.3a resolution.

PDB Compounds: (B:) phosphoribosyl-aminoimidazole synthetase

SCOPe Domain Sequences for d2btub1:

Sequence, based on SEQRES records:

>d2btub1 d.79.4.0 (B:12-167) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
ieagyeavsrmkkhvqttmrkevlgglggfggmfdlskfaleepvlvsgtdgvgtklmla
fmadkhdtigidavamcvndivvqgaeplffldyiacgkaepskienivkgisegcrqag
caliggetaempgmysteeydlagftvgivdkkkiv

Sequence, based on observed residues (ATOM records):

>d2btub1 d.79.4.0 (B:12-167) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
ieagyeavsrmkkhvqttmrkevlgglggfggmfdleepvlvsgtdggtklmlafmadkh
dtigidavamcvndivvqgaeplffldyiacgkaepskienivkgisegcrqagcaligg
etaempgmyteeydlagftvgivdkkkiv

Timeline for d2btub1:

• d2btub1 first appeared in SCOPe 2.03
  
• d2btub1 appears in SCOPe 2.07